PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT01861
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 475aa    MW: 52641.9 Da    PI: 5.5751
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT01861genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM98.31.1e-301302691128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkk....leleev.ikev.diykvePwdLpkkvkaeekewyfFskrdkkyatgkrknra.........tksgyWkat 86 
               lp+G++F+Ptd el+ e+L+ kv + +    ++ +   i+e+ +i++++P++Lp  +k + ++ +fF+k +++y  g+rk+r+          ++ +W++t
  EMT01861 130 LPAGVKFDPTDLELL-EHLEGKVGRAPshdlIDGFIPtIEEAeGICYTHPENLP-GTKMDGRNNHFFHKISNAYDVGQRKRRKisnsdhticDEHFRWHKT 228
               799************.99******99965543333334888878**********.445678999******************867777766544777**** PP

       NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
               gk+k++++++g  +g kk+Lv+   r++kg+kt+W+mh+y+l
  EMT01861 229 GKSKHIFDNNGVIKGWKKILVLS-MRSRKGQKTNWTMHQYHL 269
               **********************8.899*************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-32115288IPR003441NAC domain
PROSITE profilePS5100527.374130288IPR003441NAC domain
PfamPF023652.8E-12131269IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MDSGACFWRR PDADCLSLSA WQRRCQSEGA TSARSSESRA AQCDAADMIL ARFNGSVIDP  60
TASRCKQLAA FRHQKIITNI DLSRSFIRSL VTTIVAVIRN PTHPPPSQFE CPNCKYCIDN  120
SDVLSLWPGL PAGVKFDPTD LELLEHLEGK VGRAPSHDLI DGFIPTIEEA EGICYTHPEN  180
LPGTKMDGRN NHFFHKISNA YDVGQRKRRK ISNSDHTICD EHFRWHKTGK SKHIFDNNGV  240
IKGWKKILVL SMRSRKGQKT NWTMHQYHLG VDQDENHGEL VVSKVFYQSK KAGQPVMCPV  300
NEESDSFAGE IDPTTPMAYP PQPRPPNSGS SRTEQNQEEY AMLSGPDECP SRGATPDATY  360
PRMQPLPLDT DALQGLPDPG TPPSFSLMAS WFTGSSSHAM EDAPLSGLDE RLSRGPTSDA  420
AYPEAEGQPL PLDVETLQGN PYLGTPPDIS LPVDMQLGSQ DIFWVDSVFT REEGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581357.21e-109PREDICTED: NAC domain-containing protein 8-like
TrEMBLR7W4J10.0R7W4J1_AEGTA; NAC domain-containing protein 8
STRINGMLOC_43934.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21103799
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25580.14e-63NAC family protein